SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013576 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013576
Domain Number 1 Region: 2-65
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000152
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013576   Gene: ENSDORG00000014439   Transcript: ENSDORT00000014438
Sequence length 587
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6519:10037:19175:1 gene:ENSDORG00000014439 transcript:ENSDORT00000014438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDIEQLDPRGRTPLHLATTLGHLECARVLLAHGADVGRENRSGWTVLQEAVSTRDLELVQ
LVLRYRDYQRVVKRLAGIPVLLEKLRKAQDFYVEMKWEFTSWVPLVSKICPSDTYKVWKS
GQNLRVDTTLLGFDHMTWQRGNRSFVFRGQDTSAIVMEIDHDRRVVYTETLALAGQDREL
LLAAAQPTEEQVLSRLTAPVVTTQLDTKNISFERNKTGILGWRSEKTEIVNGYEAKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCKTPLQSFLGIAEQHGGPQNGTLITQTLSQANPTAI
TAEEYFNPNFELGNRDMGRPMELTTKTQKFKAKLWLCEEHPLSLCEQVAPIIDLMAVSNA
LFAKLRDFITLRLPPGFPVKIEIPIFHILNARITFGNLNGCDEPVPSVRGSPSSELSPGS
DSSSVSSSSSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSAPPTPQRQPVPPAPVPSPRPSPGPGSS
GRMFPSYDEQLRLAMELSAQEQEERRRRARLEEEELERILRLSLTEQ
Download sequence
Identical sequences ENSDORP00000013576 ENSDORP00000013576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]