SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013675 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013675
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-52
Family Ephrin receptor ligand binding domain 0.00000533
Further Details:      
 
Domain Number 2 Region: 272-475
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-33
Family Fibronectin type III 0.0000123
Further Details:      
 
Domain Number 3 Region: 742-850
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.17e-26
Family Protein kinases, catalytic subunit 0.00000633
Further Details:      
 
Domain Number 4 Region: 566-674
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.75e-23
Family Protein kinases, catalytic subunit 0.0000195
Further Details:      
 
Domain Number 5 Region: 875-942
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.19e-19
Family SAM (sterile alpha motif) domain 0.0000331
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013675
Domain Number - Region: 202-269,304-328
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00152
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013675   Gene: ENSDORG00000014542   Transcript: ENSDORT00000014542
Sequence length 946
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_537:15194:36439:1 gene:ENSDORG00000014542 transcript:ENSDORT00000014542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDSINEVDESFRPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCSMPGV
LGTCKTFNLYYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGP
LGKRGFYLAFDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRH
SEERDTPKMYCSAEGEWLVPIGKCVCSAGFEERRDACVACELGFYKSAPGDQLCARCPPH
SHSAAPAAQACHCDLSYYRAALDPPSSACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGG
RSDITYNAVCRRCPWALSRCEACGSGTRFVPQQTSLAQASLLVANLLAHMNYSFWIEAVN
GVSHLSPEPRHAAVVNITTNQAXXXXXXXXXXXXXXXXXXXXLWQEPEQPNGIILEYEVK
YYEKDKEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPXX
XXXXXXXXXXXXXXXXXXXXXXXXXXCKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLP
LHHPPGKLPEPQFCAEPHTYEEPGRAGRGFTREIEASRIHIEKIIGSGESGEVCYGRLRV
PGQRDVPVAIKALKAGYTERQRQDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYM
ENGSLDVFLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGE
RPYWHMTNRDVISSVEEGYRLPAPMGCPRALHQLMLDCWHKDRAQRPRFSHIVSVLDALI
HSPENLRATATAGRCPPPAFARSCFDLRGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSL
GMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLTSTQGPRRHL
Download sequence
Identical sequences ENSDORP00000013675 ENSDORP00000013675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]