SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013686 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013686
Domain Number 1 Region: 57-393
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-80
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000206
Further Details:      
 
Domain Number 2 Region: 407-500
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.29e-19
Family Anticodon-binding domain of Class II aaRS 0.0055
Further Details:      
 
Domain Number 3 Region: 4-57
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.0000000000271
Family a tRNA synthase domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013686   Gene: ENSDORG00000014553   Transcript: ENSDORT00000014553
Sequence length 509
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2226:9212:21760:-1 gene:ENSDORG00000014553 transcript:ENSDORT00000014553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAELEELVRLQGERVRSLKQQKASADQIEEEVAKLLKLKAQLGPDESKQKFVLKTPK
GTRDYSPKHMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLTGKYGEDSKLIYDLKDQ
GGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQCDFDIAG
QFDPMIPDAECLKIMCEILSSLQIGNFLVKVNDRRILDGMFAVCGVPDSKFRTICSSVDK
LDKVSWEEVKNEMVGEKGLAPEVADRIGDYVQQHGGVSLVEELLQDPKLSQNKQALEGLG
DLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGVIYEAVLLQTPAQAGDEPLGVGSVAAG
GRYDGLVGMFDPKGRKVPCVGVSIGVERIFSIVEQRLEALEEKVRTTETQVLVASAQKKL
LEERLKLISELWDAGIKAELLYKKNPKLLNQLQYCEETGIPLVAIIGEQELKDGVIKLRS
VASREEVDVRREDLVEEIRRRTNKTPCIC
Download sequence
Identical sequences A0A1S3FH22
ENSDORP00000013686 ENSDORP00000013686 XP_012875898.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]