SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013689 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013689
Domain Number 1 Region: 65-231
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.84e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00042
Further Details:      
 
Domain Number 2 Region: 431-489
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000000105
Family Anticodon-binding domain of Class II aaRS 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013689   Gene: ENSDORG00000014555   Transcript: ENSDORT00000014556
Sequence length 492
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2226:22069:30801:1 gene:ENSDORG00000014555 transcript:ENSDORT00000014556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQLGLLCRKAWAAALLSQLVRPPHAVSIRTVGGHSQXXXXXXXXXXXXXXXXXXXXXXX
XXXXXDLSPQQMVVREKILDTVVSCFKRHGAKGLDTPAFELKDMLTEKSEENFGLMYDLK
DQGGELLSLRYDLTVPFARYLAMNKLKKMKRYQVGKVWRRESPAIVQGRYREFCQCDFDI
AGQFDPMIPDAECLKIICEILSGLQLGDFLIKVSDIIDGMFAVCDVPKSKFHXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXAEMLYKENPKLLTQLHYCEDMGIPLVVIIGEQEQKEGTLKLRSVASREEAIKRE
NLVAEIKQLSLS
Download sequence
Identical sequences ENSDORP00000013689 ENSDORP00000013689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]