SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013695 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013695
Domain Number 1 Region: 231-372
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.24e-21
Family Pentraxin (pentaxin) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013695   Gene: ENSDORG00000014563   Transcript: ENSDORT00000014562
Sequence length 386
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6405:77457:84227:1 gene:ENSDORG00000014563 transcript:ENSDORT00000014562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLPALLLCALSAAAGAGPADDYELLYVNLDNELEPVQLPTDEXXPCDCRREPSEWDKLF
TMLENSQMREAMLLEATDVVLRGEMQRLRAELGRLAGGLARPCTAGPGEARLARALDELL
QGSRDASRRLARLEDAEARRPAAAAEAEAGRALSAMLRELRETRAELRAVRRWAARHGLP
AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNKTSLSYSTEQ
SSREMQLSLGPRAEELVMGGESRSATRAVAPGRWTHLCGTWGSQGGRASLWADGQLLAAA
AEVAAGHQVRAGGALRMGQEGGGGAGGVDHAPAFSGWLTGFNIWDRVLSEAEIREAGGDE
SCHVRGNVVGWGVTEILPHGGAQYLS
Download sequence
Identical sequences ENSDORP00000013695 ENSDORP00000013695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]