SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013979 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013979
Domain Number 1 Region: 660-728
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-21
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 1569-1628
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.22e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1123-1250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.63e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 1402-1459,1487-1495
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000314
Family TB module/8-cys domain 0.00033
Further Details:      
 
Domain Number 5 Region: 987-1136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000102
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 6 Region: 1215-1335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000122
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 7 Region: 544-609
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000209
Family TB module/8-cys domain 0.0023
Further Details:      
 
Domain Number 8 Region: 609-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000429
Family EGF-type module 0.005
Further Details:      
 
Domain Number 9 Region: 870-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 10 Region: 1725-1807
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 11 Region: 1467-1518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000761
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 915-954
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.0027
Further Details:      
 
Domain Number 13 Region: 957-1004
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000743
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 14 Region: 834-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000745
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 15 Region: 1512-1557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000183
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 16 Region: 1329-1367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000032
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013979
Domain Number - Region: 189-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 393-423
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00108
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013979   Gene: ENSDORG00000014858   Transcript: ENSDORT00000014858
Sequence length 1811
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2184:36623:133875:-1 gene:ENSDORG00000014858 transcript:ENSDORT00000014858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPTSARCSGSALRTPGRIFLPLTLALLLDISHAQRDPMARYEPASRDANRLRPGGSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRNVCGGQCCPGWTTAN
STNHCIKPVCQPPCQNRGSCSRPQLCICRSGFRGPRCEEIIPDEEFDPQNSRLAPRRSAE
GVPSLRRSSTTRDSLVDRAQPLTPQLTPARTLSGLSQTRPPQQHMGLSRTIRRYPAIAAN
GHLTSNALPTGLGLEQRDGTQQAVHLDNRSSPWGLNLTEKIKKIKIVFTPTICKQTCAHG
HCANSCERGDTTTLYSQGGQGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTGKFC
HLPASQQDRESPGSRSHHRALLESPLHRSTFTLPLSNQLASVNPSLVKVHINHPPEASVQ
IHQVARVRGEADRAPEENSVETRPPYRLPASTSYSHWDSNSIPARAGEPPRPPPPVVPGH
QGLLGRCYLNTVNGQCADPLLELTTQEDCCGSVGAFWGVTSCALCPPRPASPVIENGQLE
CPQGYKRLNLTHCQDINECLTLGLCKDSECINTRGSYLCTCRPGLMLDPSRSRCVSDKAV
SMHQGLCYRSLGPGTCTLPLAHRITKQICCCSRVGKAWGSKCEKCPPPGTEAFREICPAG
HGYTYSSSDIRLSMRKAEEEELARPSREHTQKSSGPLPSPAERQPLREAMDTWLEADKGD
SQAGEVTTHLPSWVPGDAIRRPTPPLPGQGISGTQEEEQVTPSTDVLVTLGPPDIDRCAS
GATNICGPGICESLPDGYRCVCSPGYQLHPSQAFCTDDNECLRDPCTGRGRCVNSVGSYS
CICYPGYTLATSGTTQECQDIDECEQPDMCSGGRCSNTEGSYHCECDQGYIMVRKGHCQD
INECRHPGTCPEGRCVNSPGSYTCLACEDGYRGQNGNCIDVNECLTPGVCAHGRCINLEG
SFRCSCELGYEITPDEKGCQDVDECASRTSCPTGLCLNTEGSFTCSACESGYWINEDGTA
CEDLDECAFPGVCPTGVCANTVGSFSCKDCDRGYRPSPLSHTCEDVDECKDTLSTCLGGE
CKNTPGSYQCLCPSGFRLANGTICEDVDECVGEEYCAPHGECLNSHGSFFCLCAPGFASA
EQGTSCQDVDECAATDPCLGGDCVNTEGSFNCMCQTGFQLSPESGECVDIDECGDYRNPV
CGAWQCENSPGSYRCVLSCQPGFYMAPTGDCIDIDECANDTVCGSHGFCDNTDGSFRCLC
DQGFETSPSGLVCVDVNECELMLAVCGAALCENVEGSFLCLCTSDLEEYDAQEGHCRPRG
AGAQSIPEAPTGDHMPGPIRMECYSGHNGDPPCSSILGQNSTQAECCCTQGARWGDACDL
CPSEDSVEFSELCPSGKGYIPVEGAWTFGQTMYTDADECVLFGPALCQNGRCLNTVPGYI
CLCNPGYHYDASHRQCQDHNECQDMACENGECMNTEGSFHCFCSPPLTLDLSGQRCVNTT
SSTEDLPDHDIHMDICWKQVTNDVCSQPLRGHRTTYTECCCQDGEAWSQQCALCPPRSSE
VYAQLCNVARIEAEREAGVHFRPGYEYGPSPDDLHYSLYGQEGAPFYNYLGPEDTAAEPP
FPNIVSQLGDTTPVLESPLQPSELQPYYMASHPELPVAFEGLQAEECGILNGCENGRCVR
VQEGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAALCAHGHCENTEGSYRCHCSPGYVA
EAGPPHCAAKE
Download sequence
Identical sequences ENSDORP00000013979 ENSDORP00000013979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]