SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014033 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014033
Domain Number 1 Region: 251-432
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.19e-58
Family Eukaryotic proteases 0.0043
Further Details:      
 
Domain Number 2 Region: 101-197
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000157
Family Hepsin, N-terminal domain 0.033
Further Details:      
 
Domain Number 3 Region: 54-92
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014033   Gene: ENSDORG00000014916   Transcript: ENSDORT00000014915
Sequence length 436
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5140:48490:64928:-1 gene:ENSDORG00000014916 transcript:ENSDORT00000014915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDLDSNQPLNSHDATPPHKPRTRLETFKRVGVPVLAALLSLVTIIIVAILIKVILNKYY
FICQHPLTFIPRTQVCDGQPDCTSGEDEADCVKDFPERPTVAVRLSKDRSTLQVLDPVTG
NWASACFDNFTEALAKTACGQMGYHSQPTFRAVEIMPDQKLIVLQVTENNQELQAQNSSG
PCVSGSLVSLQCLACGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXKYLDVSNWKVRAGSDQLGNFPSLPVAKIFVTKHNPLSPKEKDIALVKLQHPLT
FSATVRPICLPFFDETLAPATPLWVIGWGLTEQNGGKMSDTLLQATVQVIDSTRCNAEDA
YQGEVSEKMLCAGLPGGGVDTCQGDSGGPLMYQSDQWQVVGIVSWGYGCGGPSTPGVYTK
VTAYLDWIYTVRKSEP
Download sequence
Identical sequences ENSDORP00000014033 ENSDORP00000014033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]