SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014247 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014247
Domain Number 1 Region: 583-711
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000492
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 2 Region: 136-303
Classification Level Classification E-value
Superfamily ARM repeat 0.0000192
Family HspBP1 domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014247   Gene: ENSDORG00000015132   Transcript: ENSDORT00000015133
Sequence length 769
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5410:167991:172352:1 gene:ENSDORG00000015132 transcript:ENSDORT00000015133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAGSGNLGECRPPGPGRGKGHPSSTQGLQARYALDGSGRVGRCRRPAGWTMAPPRNVVKI
AVQMRDAIPQLIQLDQAKPLATVLKELCDAWNLTHSERFALQFADGHRRYITENNRAEIK
NGSILCLSTAPDLKAEQLLGELQNSSRERRREALRHLVLLASDMTFAQEVISRDGLQRLG
TIIEDGDDLGEMLALGLRAFLEFMEHGVVSWETLGIPFVRKVVSYVNMNLMDASVPPLAL
GLLESVTLSSPAMGQLVKSEVPLDRLLVHLQVMNQQLQTKAMALLTALLQGASPAERKQM
LDYLWQRNLRQFIYKNIIHSAVPLGDEMAHHLYVLQALTLGLLEPRMRTPLDPYSQEQRE
QLQALRQAAFEPEGESLGTGLSADRRRSLCAREFRKLGFSNSNPAQDLERVPPGLLALDN
MLYFSRHAPSAYSRFVLENSSREDKHECPFARSSIQLTVLLCELLHVGEPCSETAQFFPM
FFSQDQSFHELFCVSIQLLNKTWKEMRATQEDFDKVMQVVREQLARTLALKPTSLELFRT
KVNTLTYGEVLRLRQTERLHQEGTLAPPILELREKLKPELLGLIRQQRLLRLCEGTLFRK
ISSRRRQDKLWFCCLSPNHKVLQYGDVEEGANPPAPESLPEQVAVADIRALLTGKDCPHI
REKGSGKQNKDLCELAFSISYDHGEEEAYLNFIAPSKRDFYLWTDGLCALLGSPMGSEQT
RLDLEQLLTMETKLRLLELENIPIPEQPPPVPPPPTNFNFCYDCSITEP
Download sequence
Identical sequences ENSDORP00000014247 ENSDORP00000014247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]