SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014337 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014337
Domain Number 1 Region: 372-569
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.85e-69
Family Nuclear receptor ligand-binding domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 93-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014337   Gene: ENSDORG00000015232   Transcript: ENSDORT00000015231
Sequence length 571
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5521:13103:37740:1 gene:ENSDORG00000015232 transcript:ENSDORT00000015231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVIAYISSSSSASSPASCHSEGSENSFQSSSSVPSSPNSSNSDANGNPKNGDLSNIEGIL
KNDRIDCSMKTSKSSAPGMTKNHSGVTKFSGMVLLCKVCGDVASGFHYGVHACEGCKGFF
RRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRM
LIEMQSAMKTMMNSQFNGHLQNDTLIEHHEQTALPAQEQLQSKPQLEQENIKSSPPPSSD
FAKEEVIGMVTRAHKDTFMYNQEPRENSLESIQPQRERIPKNMEQYNLNHDHCGNGLNSH
FPCSESQQHLNGQYKGRNIMQYPHGHAICIANGHCVNFSNAYTQRVCDRVPIDGFSQNEN
KNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFAKRIPGFRD
LSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFE
FSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKNHPNEA
SIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences ENSDORP00000014337 ENSDORP00000014337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]