SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014363 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014363
Domain Number 1 Region: 12-77
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000105
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000213
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 3 Region: 112-169
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000277
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014363   Gene: ENSDORG00000015260   Transcript: ENSDORT00000015260
Sequence length 314
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_459:5815:69280:1 gene:ENSDORG00000015260 transcript:ENSDORT00000015260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNMRESVVRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNECFLRR
ASCKHQKEITVVARGPCYSDNGSGSGEGEEEGSGAEAHRKHSKCGPCKYKAECDEDAENV
GCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDMSLLGK
KDDGLQYSPDVKDASDQREDVYVGSHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGYT
GQYCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNRGRRQKQ
NLGHFTSDTSSRMV
Download sequence
Identical sequences ENSDORP00000014363 ENSDORP00000014363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]