SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014494 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014494
Domain Number 1 Region: 169-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000029
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 2 Region: 131-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000144
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 925-976
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000823
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 686-734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000046
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 5 Region: 474-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000628
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 774-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000679
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 7 Region: 1192-1242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000104
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Domain Number 8 Region: 658-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000643
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014494
Domain Number - Region: 715-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000485
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number - Region: 290-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000541
Family Classic zinc finger, C2H2 0.056
Further Details:      
 
Domain Number - Region: 1160-1202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000625
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number - Region: 402-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00171
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 255-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00416
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 57-80
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00416
Family Classic zinc finger, C2H2 0.055
Further Details:      
 
Domain Number - Region: 877-934
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0146
Family Classic zinc finger, C2H2 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014494   Gene: ENSDORG00000015403   Transcript: ENSDORT00000015402
Sequence length 1270
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1285:13333:236962:-1 gene:ENSDORG00000015403 transcript:ENSDORT00000015402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEGEASDFSLAWDSSVTAAGGLEGEPECDRKTSRALEDRNSVTSQEERNEDDEDMEDESI
YTCDHCQQDFESLADLTDHRAHRCPGDGDDDPQLSWVASSPSSKDVASPTQMIGDGCDLG
LGEEEGGTGLPYPCQFCDKSFIRLSYLKRHEQIHSDKLPFKCTYCSRLFKHKRSRDRHIK
LHTGDKKYHCHECEAAFSRSDHLKIHLKTHSSSKPFKCSVCKRGFSSTSSLQSHMQAHKK
NKEHLAKSEKEAKKDDFMCDYCEDTFSQTEELEKHVLTRHPQLSEKADLQCIHCPEVFVD
ENTLLAHIHQAHANQKHKCPMCPEQFSSVEGVYCHLDSHRQPDSSNHSVSPDPVLGSVAS
MSSATPDSSASVERGSTPDSTLKPLRGQKKMRDDGQGWSKVVYSCPYCSKRDFTSLAVLE
IHLKTIHADKPQQSHTCQICLDSMPTLYNLNEHVRKLHKSHTYPVMQFGNISAFHCNYCP
EMFADINSLQEHIRVSHCGPNANPPDGNNAFFCNQCSMGFLTESSLTEHIQQAHCSVGSA
KLESPVVQPTQSFMEVYSCPYCTNSPIFGSILKLTKHIKENHXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKFSNFESFQTHLKLHLELLLRKQACP
QCKEDFDSQESLLQHLTVHYMTTSTHYVCESCDKQFSSVDDLQKHLLDMHTFVLYHCTLC
QEVFDSKVSIQVHLAVKHSNEKKMYRCTACNWDFRKEADLQVHVKHSHLGNPAKAHKCIF
CGETFSTEVELQCHITTHSKKYNCKFCSKAFHAIILLEKHLREKHCVFDAATENGTANGV
PPATTKKAEPADLQGMLLKNPEAPNSHEASEDDVDASEPMYGCDICGAAYTMEVLLQNHR
LRDHNIRPGEDDGSRKKAEFIKGSHKCNVCSRTFFSENGLREHLQTHRGPAKHYMCPICG
ERFPSLLTLTEHKVTHSKSLDTGTCRICKMPLQSEEEFIEHCQMHPDLRNSLTGFRCVVC
MQTVTSTLELKIHGTFHMQKLAGSSAASSPNGQGLQKLYKCALCLKEFRSKQDLVKLDVN
GLPYGLCASCMARSANGQVGGLAPPEPTDRPCAGLRCPECSVKFESAEDLESHMQVDHRD
LTPETSGPRKGAQTSPVPRKKTYQCIKCQMTFENEREIQIHVANHMIEEGINHECKLCNQ
MFDSPAKLLCHLIEHSFEGMGGTFKCPVCFTVFVQANKLQQHIFAVHGQEDKIYDCSQCP
QKFFFQTELQ
Download sequence
Identical sequences ENSDORP00000014494 ENSDORP00000014494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]