SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014524 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014524
Domain Number 1 Region: 102-295
Classification Level Classification E-value
Superfamily vWA-like 1.34e-55
Family Integrin A (or I) domain 0.00034
Further Details:      
 
Domain Number 2 Region: 779-948
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-20
Family Laminin G-like module 0.053
Further Details:      
 
Domain Number 3 Region: 319-477
Classification Level Classification E-value
Superfamily Fibronectin type III 6.04e-18
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 4 Region: 494-653
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000444
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014524   Gene: ENSDORG00000015431   Transcript: ENSDORT00000015432
Sequence length 1229
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1172:534:21547:1 gene:ENSDORG00000015431 transcript:ENSDORT00000015432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSGQEVMLTTKTPKATVGGLSPSKGHTLQIFELTGSGPVQRDFVIDALKRSPGRXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPHFRCTPPVPTDMVF
LVDGSWSVGHSHFQQVKDFLTSVIEPFEIGPDKVQVGLTQYSGDPRTEWELSAFRTREQV
LAAVRSLRYKGGNTFTGLALTHVLGWNLQRAAGLRPEAAKVVVVVTDGKSQDDVRTAARV
LRDLDVHVFAVGVKNADEAELKLLASWPLDITVHNVLDFPQLATLAGLLSRLICQKVQGR
SPGRSPAPVSALPPLPASASLDFTRVTSSSLHLSWTPAPQPPLKYLVVWRSSRGSVPREL
LVEGAASSLELHNLTASTQYLVSVLPVYEGGAGEGLQGLATTAPLPPPQALTLAAVTSRT
LHLTWQPSAEAAQYLVRCLPASPPGEEQRREVRVGRPEVLLGGLEPGRSYEVSVQSLRGP
EVSEARRLRARTSAPAPTRHLNFTNVSHSSAHVSWEATRRPLRLVRVSYVSSDGGHSGQM
QVSGVATSAALGPLSSSTTYAVRVTHLYLGGGSSSLTGRVTTRRAPSPSQLSVTELPGDA
VRLSWVAVGSPGALGYHIKWTPLGEGEAREISVAGAVRTAVLPGLSRHAEYEITXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCPAPSAHGTLPG
FDLMGAFGLVATEYASTPGVAMGPWAWGWAPTFTLFKDAQLTRRARDVHPALPPEHTIVF
LVRMLPETPREAFALWQMTTEDFRPLLGVLLDAGRKSLTYFNHAAGSPTQATFDLPEAKK
IFFGSFHKVHVAVGPSKVRLYVDCRKVAERPIGGAGSPPATGLVTLGRLAKARGPEDSSX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGMRGLEGPAGLPGPGPRGLQGLAGSRGSNGERGPPGAV
GPTGLPGPKGERGEKGEPQSLTAIFQLVSQACESAIQMHVRRLNSFLHENARPPMPILAG
TAEPGEPAAIGQTGSPGLGGASLQLPSDE
Download sequence
Identical sequences ENSDORP00000014524 ENSDORP00000014524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]