SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014654 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014654
Domain Number 1 Region: 398-596
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-66
Family Nuclear receptor ligand-binding domain 0.0000234
Further Details:      
 
Domain Number 2 Region: 117-206
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-29
Family Nuclear receptor 0.0000127
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014654   Gene: ENSDORG00000015568   Transcript: ENSDORT00000015568
Sequence length 599
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6101:170050:176989:-1 gene:ENSDORG00000015568 transcript:ENSDORT00000015568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLDSNNNTGGVITYIGSSGSSPRISPESYSDNNSQLTQGCYPPSPTGLQDPARSFESI
PPSLSDDGSPSSSSSSSSSSSFYNGSPPGSLQVAMEDGSRVSPSKSTSNITKLNGMVLLC
KVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKK
CLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSSTQHPTSGPMGP
SPPPAPAPSPLVGFSQFPQQLTPPRSPSPEPTMEDVISQVARAHREIFTYAHDKLGTSPS
NFNANHTSGSPAVTTPRWESPGCPPANDNNTLAAQRHNEALNGLHQGPSSYPPAWPPGPT
HHGCHQPNSNGHRLCPTHMYSAPEGEAPANGPRQSNSKNVLLACPMNMYPHGRSGRTVQE
IWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQT
VMFLSRTTYSLQELGAMGMGDLNAMFDFSEKLNSLALTEEELGLFTAVVLVSADRSGMEN
SASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTLNNMHSEKLLSFRVDAQ
Download sequence
Identical sequences ENSDORP00000014654 ENSDORP00000014654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]