SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014749 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014749
Domain Number 1 Region: 203-383
Classification Level Classification E-value
Superfamily MIR domain 3.14e-47
Family MIR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1063-1154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-18
Family SPRY domain 0.045
Further Details:      
 
Domain Number 3 Region: 3857-3935
Classification Level Classification E-value
Superfamily EF-hand 0.0000000228
Family Calmodulin-like 0.029
Further Details:      
 
Domain Number 4 Region: 421-533
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000235
Family IP3 receptor type 1 binding core, domain 2 0.019
Further Details:      
 
Domain Number 5 Region: 643-776
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000269
Family SPRY domain 0.041
Further Details:      
 
Domain Number 6 Region: 2013-2078
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.00000353
Family IP3 receptor type 1 binding core, domain 2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014749
Domain Number - Region: 1309-1434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000269
Family SPRY domain 0.025
Further Details:      
 
Domain Number - Region: 2014-2088,2371-2444,2509-2531,2873-2893,2973-3008
Classification Level Classification E-value
Superfamily ARM repeat 0.000932
Family MIF4G domain-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014749   Gene: ENSDORG00000015668   Transcript: ENSDORT00000015674
Sequence length 4819
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6541:31747:308546:1 gene:ENSDORG00000015668 transcript:ENSDORT00000015674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDEVVLQCIANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYIPPDLCVCSFVLEQSLSVR
ALQEMLASTGEDGGEGAAQGGGHRTLLYGHAILLRHSFSGMXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLSISNGSIQVDASF
MQTLWNVHPTCSGSGVEEGYLLGGHVVRLFHGRDECLTIPSTDQNDAQHRRLFYEAGGAG
MRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTEDQGLLLQDRGKADTKSTA
FCFRASKEIKEKLDSSHKRDMEGMGIPEIKYGDSVCFVQHVASGLWVTYKAQDAKTSRLG
PLKRKVILHQEGHMDDGLTLQRCQREESRAARIIRNTTALFSQCLSGNNRTAAAAIALPV
EEVLQTLQDLIAYFEPPEEGLRHEEKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNVYN
SVAHFAGLAREESSLAWKEVLNLLYKLLAALIRGNRNNCAQFSTNLDWLISKLDRLESSS
GILEVLHCILIESPEALNLIAEGHIKSIISLLDKHGRNHKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAE
PTHLRVGWASSPGYAPYPGGGEGWGGNGVGDDLHSYGFDGLHLWSGRIPRAVASINQHLL
RSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVMSFSAGVKVRFLMGXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKRQHPCLVEFSKLPETEK
NYNLQMSTETLKTLLALGCHIAHVNPAAEEELKKVKLPKNFMMSNGYKPAPLDLSDVKLL
PPQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDS
LREAVRTFVGYGYNVEPSDQELADPAVEKVSIDKLRFFRVERSYAVRSGKWYFEFEVVTG
GAMRVGWARPGCRPDVELGADDQAFVFEGSKGQRWHQGSGYFGRTWQPGDVVGCMINLDD
ASMIFTLNGELLITNKGSELAFADYDIENGFVPICSLGLSQGRMNLGTDASTKFYTMCGL
QEGFEFAVNMNRDAMWFSKRLPTFVNVPKDHPHIEVVRIDSTMDSPPCLKVTHKTFGTQN
SNANMIYCRLSMPVECHSFSHSSCLDSDVFQKRKQMHEILSPTTTQCHYAVRIFAGQDPS
CVWVGWVTPDYHLYSEKFDLNKNCTVTVTLGDERGRVRESVKRSNCYMVWGGDVVASSQR
PTRSNVDLEISCLVDLAMGMLSFSANGKELSTCYQVEPNTKVFPAVFLQPTSTALFQFEL
GKLKNAMPLSAAIFKSEEKNPIPQCPPRLDVQTMQPVLWSRMPSSFLKVETERVSERHGW
AVQCLEPLQMMALYIPEENRCVDILELCEQEDLMQFHYHTLRLYSAVCALGNSRVACALC
SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPEISSSLLKTKGAWALL
TEAVHSSGAHIRDPVGGSVEFQFVPVLKLIGTLLIMGVFDDDDVRRILLLIDPSVFGERA
GETEEGTEKEEATQVEEKAVEAGEKAGKKAPARGLLQTRMPESVKLQLCKLLSYLCDCEL
QHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTARKTREFRSPPQEQHGDLLL
HCGVPVEEEEEEEEDSSWPGRLRALVYKIKGPPRPEKMKRAEEEERYPATLRELVSQTMI
CWAQENQIQDAELVRVMFDLLRRQYDSTGELLRALRKTYTISQASVSDTGQLLAALGQIR
SLLSVRMGKEEEQLMIHGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGTEKSQIT
FPKMVASCCRFLCYFCRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVM
DNNELALGLEEPDLEKVVTYLAGCGLQSCPLLLAKGYPDIGWNPIEGERYLTFLRFAVFV
NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXSSEGDGEEDAVVHMGNAVMSFYSALIDLLGRCAPEMHLIQAGKGEAIRIRSILRSLVP
TEDLVGIVSIPLKLPSLNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGVEDQAFLLHLL
EVGFLPDLRASASLDTVSLSTTEAALALNRYMCSAVLPLLTRCAPLFAGTEHHTSLIDST
LQTIYRLSKGRSLTKAQRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLK
LLTSHYEQCWKYYCLPAGWGGHGMAVEEELHLTEKLFWGIFDSLSRKKYDPDLFLMALPC
LSAIAGALPPDYLDTRITAVLEKQVSVDADGNFDPKPINTMNFSLPEKLESIVTKYAEHS
HDKWACDKSQSGWKYGISLDENVKTHPLMRPFKTLTEKEKEIYRRPARESLKTMLAVGWA
VERTREGEASVQQRENEKLRSALQTSQGSSYSPAPLDLSNVVLSRELQGMVEVVAENYHN
IWAKKKKSELESKGGGSHPLLVPYDTLTAKEKFRDREKAQDLFKFLQVNGIIVSRGAKDT
ELDASSMKRFAYKFLKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLV
DQYFTNHRLYFLSSPLKPLSSCGYASHKEKEMVASLFCKLAALVRHRISLFGNDASTMVS
CLHILAQTLDTRTVVKSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDVQISCYRILCSLYSLGTGRNIYVERQ
RPALGECLASLXXXXXXXXXXXXXXRYNPLSVFNTKTPRERSILGLPDMVEDMCPGVPPL
EGLMKEIGSLAESGARYSEMPHVIEVTLPMLCSYLSYWWAHGPEGLPPSAGPCCTTVTSE
HLSLILGNILKIINNNLGIDEASWMKRIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNWLKSPDAD
SDQLFRMVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKVTPAASGGQD
QERKKTKRRGDLYSIQTSLIVATLKKMLPVGLNMCTPGDQELISLAKSRYGCRDTDEEVK
EHLRNNLHLQEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLEEDPLYTSYSSMMAKSC
QSGEDEDEEEDKEKTFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEMSPMVVET
LKLGIAILNGGNTGVQQKMLDYLKEKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLG
MVTEEGTLIVRERGEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNIII
STVDYLLRLQESISDFYWYYSGKNVIDESGQHNFSKALAVTKQIFNSLTEYIQGPCVGNQ
QSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVN
GTIGKQMVDTLVESSTNVEMILKFFDMFLKLKDLTGSDAFKEYDPDGKGIISKREFQKAM
EGQKQYAQSEIDFLLSCAEADENDLFNYVDFVDRFHEPAKDIGFNVAVLLTNLSEHMPND
PRLKCLLDPAESVLKYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQF
IFDVVNEGGEQEKMELFVSFCEDTIFEMQLASQISESDSADRPEEEEEGEEEESSCALGT
EGQEEEDGSLECASAFAVACAAAKRSAAALLRRATLRNLRRQCRSVRKMAARELAQACLG
LASALCLGLLRGLLALLAGLAQALWSTVFGGGLVEGARNIRVTKILGDMPDPTQFGIHDD
ATEAERADAGELRAAAEPGHAVKGGKGDADLMPDLFGLHPNKEGPAVGLGDLSEVIGKAE
PPTLESTVRRKRKAQVAAAARAAQAADLNAESEKADMEDREKEDEAKEEGQAEVLWTAVT
KRKPHRRGQKAEKPEAFMANFLKGLDTYQTKLLHYLARNFYNLRLLALFVAFAINFILLF
YKVTEEPLEETEDVANLWNSFNEEDEEEAVVFFVLQESTGYMAPALGALAVVHTVISLVC
VVGYYCLKVPLVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVVNTPSFPNNYWD
KFVKRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSSIDMKYHIW
KLGVVFTDNSFLYLAWYTTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCYLFHMYVGVRAGGGIG
DEIEDPAGDPYEMYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKC
FICGIGNDYFDTTPHGFETHTLQEHXXXXXXFFLMYLINKDETEHTGQESYVWKMYQERC
WDFFPAGDCFRKQYEDQLA
Download sequence
Identical sequences ENSDORP00000014749 ENSDORP00000014749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]