SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015652 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015652
Domain Number 1 Region: 107-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 150-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000509
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 75-121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000333
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 754-804
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000673
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 192-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000398
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015652
Domain Number - Region: 11-41
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00888
Family Classic zinc finger, C2H2 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015652   Gene: ENSDORG00000016638   Transcript: ENSDORT00000016637
Sequence length 1037
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_792:5800:51658:-1 gene:ENSDORG00000016638 transcript:ENSDORT00000016637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSEDYSHETMAPHIHEWQYRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDFQQL
ESEELREIHAIQECTCDQAFPDSQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIRHQMS
HDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKHIHSS
VKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCEGKNH
FAAGGFFGQSISLPGNPAMDKTSMVNMSHANPGLADYFGANRHPAGLTFPTAPGFSFSFP
GLFPSGLYHRPPLIPASSPVKALSSTEQSNKSQSPLMTLPATQDILKALSKHPPVGDNEP
VALQPEGSSEEGPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESDKEKCKENG
KMFKDKGSPLQNLASINNKKEYSNHSIFSPSLEEHTAVSGAVNDSIKAIASIAEKYFGST
GLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPPSPNEVKKLPKG
VSESPFDLTTKRKDEKPLTQVPSKPPATPATSQDQPLDLSMGTRSRASGTKLSEPRKNHV
FGEKKGSHSEARPSADSSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYLRPSPGFLF
HPQFQLPDQRTWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCKYCDRSFSISSNLQRHVRNIHNKEK
PFKCHLCDRCFGQQTNLDRHLKKHENGNMSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXMSGSHFKDEKALVTSQNSDILDDVDDVLLDEEDDDITGKPA
GAVMGXXXXXXXXXXXXXXXXXXXXXXXXXXXYKEEEYKSGLSALDHIRHFTDSLKMRKM
EDNQYTEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKDSLHSTSHSSSSMWHS
MARAGAEASAIQSISHV
Download sequence
Identical sequences ENSDORP00000015652 ENSDORP00000015652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]