SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015711 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015711
Domain Number 1 Region: 738-982
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.83e-60
Family Nuclear receptor ligand-binding domain 0.000000125
Further Details:      
 
Domain Number 2 Region: 603-685
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.69e-24
Family Nuclear receptor 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015711   Gene: ENSDORG00000016701   Transcript: ENSDORT00000016701
Sequence length 984
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_543:181913:392983:-1 gene:ENSDORG00000016701 transcript:ENSDORT00000016701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKGYHNLVEGPDMERRWSEVSQAAEPSLGPPERTDEKSYMQVVDVNCVSGAIPNDSTQ
GSSREKHELLPCLQQDSSRCGILTSDIKTELDSKELSATVAESMGLYMDSVREPDYSYDQ
QNAPGSLSPAKIYQNMEQLVKFYKENGHRPSTLGSGSRPLRSFLSDSGSSTNVGGGGVMR
AMVKSPILCHERSPSVCSPLNMATSACSPAGISSVSSTSASFGSFPVHSPITQGTPLMCS
PNVETRGSRSHSPAHASNVGSPLSSPLSSMKSPVCSSPSHCSVKSPVSSPHNVTLRSSVS
SPANLHNSRCSVSSPSNTNNRSTLSSPTASTVGSICSPMSNAFGYAASGTCAGASATRDV
ASSPDTHEKGAHEVPFPKTEEVENAISNGVAGQLSLVQYIKPEPDGAFRSSCLGGNNKIT
SESPFSVPIKQESTKHSCSGDSFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVP
GFDASCEGGGFPVGIKQEPDDGSYYPEASIPPASAIVGVNSGGQSFHYRIGAQGTISLSR
SPRDQSFQHLSSFPPVNTLVESWKSHSDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSS
RPSKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGKCSWQHNYLCAGRNDCIIDKIRRK
NCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQSQQPPPPPQSPEEGTTYIAPAKEPS
VNTALVPQLSSISRALTPSPVMILESIEPEVVYAGYDGSKPDTAENLLSTLNRLAGKQMI
QVVKWAKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQYLYFAPDLVFNEE
KMHQSAMYELCQGMHQISLQFVRLQLTFEEYTVMKVLLLLSTVPKDGLKCQAAFEEMRTN
YIKELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLECFYTFRESQALRVEFPAML
VEIISDQLPKVESGNARALYFHRK
Download sequence
Identical sequences ENSDORP00000015711 ENSDORP00000015711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]