SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015770 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015770
Domain Number 1 Region: 459-543
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000781
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 114-159
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000144
Family Elafin-like 0.0013
Further Details:      
 
Domain Number 3 Region: 647-686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000103
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015770
Domain Number - Region: 548-642
Classification Level Classification E-value
Superfamily SEA domain 0.00111
Family SEA domain 0.018
Further Details:      
 
Domain Number - Region: 258-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0838
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015770   Gene: ENSDORG00000001772   Transcript: ENSDORT00000019769
Sequence length 1074
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5963:3964:35767:1 gene:ENSDORG00000001772 transcript:ENSDORT00000019769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTTLGLALLAWAGALGLSQGSSFTEKGLSLLSYQLCNYHVTRRVQKVEAVQTSRVIYTS
CGGWIPWRQCPKTVYQTQYLATEVPESKNVTDCCEGHEQLGLYCVLPLNRSREFASRPGS
CPASEPELPTPRRCSWDTDCPGLQKCCPWPAGHRCTAPVPRAAKRSLVSWYNITVLVKMD
FEDLQQVDPGFRNHTRLLYSVTSALQPLNPAVHYLHSAGGDTFTTVSWLLLGLTRLLPVA
NVSAMLDDMVKRVYEVINIQVQDVNECLYDELHTCSEAELCQNMEGSHLCVRAQESSTSS
PQRPNHTDSGDVVNSTGSGLSAVAGVTVPALDSGTAVPSPESLTLSPSPWTPQGTPATSQ
AQTPGPPSRRGAGDLGSHDRNSTGPGAEEELLGNTTTEPPSPPTTKDASGHVVWHTGLPP
RETPVNAATLQTKEPEPAPGPGLPSAPTPVPLQHPACGPGSITRVTVSNVSSTGFHLQWA
ADPAPLPTFHLSLVPARGPAVSVDTQNTSVALSGLEPGVLHLVQITARACGKEGTRTDLK
VRTAAQKLRGKVRIANVRYSEALGNTSSQEHRDFLGRFLSTVREPLPAMLRQHMDAGGIR
LNVTSITNGSVVVDFTLLVIADVDIREVSAAFLSALHNASRLEVVRGDPFIQDFDECASM
EHDCVPGTACHNTLGSFVCSCAGGASNFHVEFSGRPCEGASPGNASQAPGPEQPLPPAGT
RAGAVPGASSAAQGRAPRLTLTEAVDVSCEVEKVALAVQRRFLQQESIPAASLYLGQPSC
NASSSNGSHVFLVAGWGECGTLVQSNMTDTVVRTTLRNDLSPEGVLHHPKILSPILCAFR
NNLLASSGYAPQWGVYTIVEDLHGAGNFVTEMQVFIGDSPIPQNYSVSASDDVKIEVGLY
RQKSNLRVVLMECWATPSSNARDPVTFGFINNSCPIPNTYTSVIQNGDSSKAQFKLRIFS
FVNNSIVYLHCKLRVCLENPGATCKISCRNFRSVSNSEDSEFFQMSWGPLMRSERRPPCV
KPGPGAGLILLIVGAVLVVVGAAAAFLITRYQRMTGNYNLKAQAGNFGYQVFYE
Download sequence
Identical sequences ENSDORP00000015770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]