SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015820 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015820
Domain Number 1 Region: 175-405
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-60
Family Nuclear receptor ligand-binding domain 0.0000000256
Further Details:      
 
Domain Number 2 Region: 125-202
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.2e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015820   Gene: ENSDORG00000005752   Transcript: ENSDORT00000019852
Sequence length 407
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_192:23233:241196:-1 gene:ENSDORG00000005752 transcript:ENSDORT00000019852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGNGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQH
Download sequence
Identical sequences ENSDORP00000015820 ENSDORP00000015820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]