SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000002 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000002
Domain Number 1 Region: 658-715
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000135
Family SH2 domain 0.0000771
Further Details:      
 
Domain Number 2 Region: 370-425
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000066
Family SH2 domain 0.0000666
Further Details:      
 
Domain Number 3 Region: 5-80
Classification Level Classification E-value
Superfamily SH3-domain 0.000000254
Family SH3-domain 0.00027
Further Details:      
 
Domain Number 4 Region: 104-188
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000151
Family BCR-homology GTPase activation domain (BH-domain) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000002   Gene: ENSMICG00000000002   Transcript: ENSMICT00000000002
Sequence length 725
Comment pep:novel genescaffold:micMur1:GeneScaffold_957:205:11940:1 gene:ENSMICG00000000002 transcript:ENSMICT00000000002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAEGFQYRALYPFRRERPEDLELLPDDVLVVSRAALQALGVREVAHCPQTVRCMPGLN
ERTPQRNDFPGTYVEFLSPMTLVRPGPRPCVQRPLPAPRDGPPEPGLALPDLPEQFSPPD
AAPPLLVKLVEAIERAGLDGEPYHRPELPAPRTDWSLSDVDQWDATALADGIKGFLLALP
APLVTPEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHYHHESLAQYNAKLDTRLL
YPVSKYQQDQLVKEDSVEAVGAQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMMRTAIE
AFNEIIILKKQGQTQEKCSKEYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLE
QQLRAQASDNREIDKRMNSLKPDLMQLRKIRDQYLVXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDG
DTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGP
PPAAR
Download sequence
Identical sequences ENSMICP00000000002 ENSMICP00000000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]