SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000062 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000062
Domain Number 1 Region: 374-626
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-70
Family Protein kinases, catalytic subunit 0.000000000293
Further Details:      
 
Domain Number 2 Region: 10-136
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-32
Family SH2 domain 0.00000015
Further Details:      
 
Domain Number 3 Region: 196-260,362-389
Classification Level Classification E-value
Superfamily SH2 domain 4.01e-18
Family SH2 domain 0.0000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000062   Gene: ENSMICG00000000066   Transcript: ENSMICT00000000067
Sequence length 634
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3211:162491:209172:1 gene:ENSMICG00000000066 transcript:ENSMICT00000000067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKA
HHYTIERELNGTYAIAGGRTHASPADLCHYHSQESDGLICLLKKPFNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQLV
EHYSYKADGLIRVLTVPCQKIGTQGDVNFGGRPQLPSSHPAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPREALPMDTEVYESPYADPEELRPK
EVYLDRNLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEA
NVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKFLQQNRHVKDKNIIELVHQVSMG
MKYLEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAP
ECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPPGCPREM
YELMNLCWTYEVENRPGFAQVEPRLRNYYYDVVN
Download sequence
Identical sequences ENSMICP00000000062 ENSMICP00000000062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]