SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000141 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000000141
Domain Number - Region: 27-52
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0621
Family MATH domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000141   Gene: ENSMICG00000000157   Transcript: ENSMICT00000000157
Sequence length 196
Comment pep:known_by_projection scaffold:micMur1:scaffold_12693:2630:8596:1 gene:ENSMICG00000000157 transcript:ENSMICT00000000157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTGKCARCVGLSLIPLSLVCIVANALLLVPNGETTWTNGHLSLQVWLMAGFIGGGLMVL
CPGIAAVRAGGKGCCGAGCCGNRCRMLRSVFSSAFGVLGALYCLSVSGAGLRIGPKCLMN
GKWSYHLEDTSGAYLLNRTQWDLCEQPPHVVPWNVTLFSLLVAASCLEIVLCGIQLVNAT
IGVFCGDCRRKEGAPH
Download sequence
Identical sequences XP_012634886.1.48125 ENSMICP00000000141 ENSMICP00000000141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]