SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000234 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000234
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.7e-75
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000203
Further Details:      
 
Domain Number 2 Region: 211-407
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 2.48e-59
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0000165
Further Details:      
 
Domain Number 3 Region: 546-709
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.31e-39
Family AlaX-like 0.03
Further Details:      
 
Domain Number 4 Region: 464-542
Classification Level Classification E-value
Superfamily Translation proteins 7.32e-16
Family AlaX-M N-terminal domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000234   Gene: ENSMICG00000000255   Transcript: ENSMICT00000000257
Sequence length 917
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2827:37024:53517:-1 gene:ENSMICG00000000255 transcript:ENSMICT00000000257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKPIFLNTIDPSHPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGD
YFKELACKMALELLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDGKILP
GNMKDNFWEMGDTGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNRETDG
ILKPLPKKSIDTGMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGADDA
DGIDMAYRVLADHARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFAT
LVDVVVGDAFPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDSKTIPGDTA
WLLYDTYGFPVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIE
ELRAKGLEVIVFSGKYNYHSDSSGSYMFENTVATVMALRREKMFVEEVSTGQECGVVLDK
TCFYAEQGGQIYDEGYLVKVDDSSEDKTEFTVKNAQVRGGYVLHIGTVYGDLKVGDQVRL
FIDEPRRRPVMSNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKK
AEEIANEMIEAAKPVYIQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSELLDDPS
GPAGSLTSVEFCGGTHLRNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKAESLN
KSLSVMEAKVKAQTAPNKDVQREIADLGESLATAVIPQWQKDELRETLKSLKKIMDDLDR
ASKADVQKRVLERTKQLIDSNPNQPLVILEMESGASAKATQGLGQLFKTHSPQTSAMLFT
VDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEA
LQLATSFAQLRLGAVKN
Download sequence
Identical sequences ENSMICP00000000234 ENSMICP00000000234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]