SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000285 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000285
Domain Number 1 Region: 20-143
Classification Level Classification E-value
Superfamily Lysozyme-like 4.35e-35
Family C-type lysozyme 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000285   Gene: ENSMICG00000000313   Transcript: ENSMICT00000000313
Sequence length 145
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_657:526838:536724:-1 gene:ENSMICG00000000313 transcript:ENSMICT00000000313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVVLSLIGCLVFPSSARIIGRCTVAKKLHQGGLTYYEGYSLENWVCLAYFESKFNPT
AVYDNAPGGYTGYGLFQIRSNDWCGHGKSRCHTECSALLNQNLQKTIECVKIIVKGKDGM
GSWPTWSRFCQYSDTLARWLDGCKL
Download sequence
Identical sequences A0A077S9K7
ENSMICP00000000285 ENSMICP00000000285 XP_012625703.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]