SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000287 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000287
Domain Number 1 Region: 137-179
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000148
Family SH2 domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000287   Gene: ENSMICG00000000315   Transcript: ENSMICT00000000315
Sequence length 179
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_939:4366:6615:1 gene:ENSMICG00000000315 transcript:ENSMICT00000000315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEVDTEYSDPFDARPLRPSPDDGYMEPYDAQRVLSELPCRGVQLYDTPYEEQDQGTGDGP
PSGQKPQQSRLPQEDERPAEEYDQPWEWKKDHISRAFAXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXWFHGPLNRADAENLLALCKEGSYLVRLSETSPQDCSLSL
Download sequence
Identical sequences ENSMICP00000000287 ENSMICP00000000287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]