SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000360 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000360
Domain Number 1 Region: 128-169
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000360   Gene: ENSMICG00000000392   Transcript: ENSMICT00000000392
Sequence length 261
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3369:1305:6266:-1 gene:ENSMICG00000000392 transcript:ENSMICT00000000392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STSGWMAQGRAPGTAALGLALRLLLGLAVGLEAAPTRFPTRTSTQAAXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEPCAQSRHCPPPAGRPCSCDGIGNCTDEE
LRNCSRPACPAGEQPCAQGDTCIPRTWRCDGHPDCPDLSDELGCGPKETFQKGNATTTWT
PVTPESVTSLGNATVYSIWDQFGNPSTYGVIIAAMMLIMTLVTAALLVLCWLQAQGRLPP
PGLLVAVKESLLPLGRKTSLV
Download sequence
Identical sequences ENSMICP00000000360 ENSMICP00000000360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]