SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000463 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000463
Domain Number 1 Region: 145-296
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-32
Family BCR-homology GTPase activation domain (BH-domain) 0.000000534
Further Details:      
 
Domain Number 2 Region: 615-720
Classification Level Classification E-value
Superfamily SH2 domain 8.62e-30
Family SH2 domain 0.000000938
Further Details:      
 
Domain Number 3 Region: 4-83
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-17
Family SH3-domain 0.00000475
Further Details:      
 
Domain Number 4 Region: 376-431
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000202
Family SH2 domain 0.0000406
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000000463
Domain Number - Region: 303-341
Classification Level Classification E-value
Superfamily SH2 domain 0.0996
Family SH2 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000463   Gene: ENSMICG00000000508   Transcript: ENSMICT00000000509
Sequence length 723
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2420:750142:818677:1 gene:ENSMICG00000000508 transcript:ENSMICT00000000509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLSGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKTEADIEQQQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXLECSTLYRTQSSSSPAELRQLLDCDTASVDLEMIDV
HVLADAFKRYLLDLPNPVIPVAVYSEMISLAPEVQSSEEYIQLLKKFIRSPNIPHQYWLT
LQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMIFRFPATSSDNTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEEYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNEKEIQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXQYSLKDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACS
VVVDGEVKHCVINKTAPGYGFAEYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVYAQ
QRR
Download sequence
Identical sequences ENSMICP00000000463 ENSMICP00000000463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]