SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000466 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000466
Domain Number 1 Region: 42-131
Classification Level Classification E-value
Superfamily SH2 domain 7.94e-24
Family SH2 domain 0.00000639
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000432
Family SOCS box-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000466   Gene: ENSMICG00000000514   Transcript: ENSMICT00000000512
Sequence length 198
Comment pep:novel genescaffold:micMur1:GeneScaffold_4520:69434:90790:1 gene:ENSMICG00000000514 transcript:ENSMICT00000000512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLESSGNGADGTRSQWGTAGSAEEPSPEAARLAKALRELGQTWYWGSMTVNEAKEK
LKEAPEGTFLIRASSHSNYLLTISVKTSAGPTNLRIEYQDGKFRLDSTIGVKSKLKQFDS
VVHLIDCYVQMCKDKRTGPEARHPHGTVHLYLTKPLCTSAPPLQHLCGLTINKCTGAIWG
LPLPTRLKDCLEEYKFQV
Download sequence
Identical sequences ENSMICP00000000466 ENSMICP00000000466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]