SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000530 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000530
Domain Number 1 Region: 2-239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.14e-45
Family BAR domain 0.0039
Further Details:      
 
Domain Number 2 Region: 343-524
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00000129
Further Details:      
 
Domain Number 3 Region: 650-731
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-16
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000530   Gene: ENSMICG00000000588   Transcript: ENSMICT00000000589
Sequence length 732
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3481:1941893:2181983:1 gene:ENSMICG00000000588 transcript:ENSMICT00000000589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAAQRKFAHSLRDFKFEFIGDAETDDERCIDASLREFSNFLKNLEEQREIMXXXXXXXX
XXXXXXXXXXXXXXXXEEKKKFDKETEKNYSIIDKHLNLSAKKKDSHLQEADIQVEQNRQ
HFYELSLEYVCKLQEIQERKKFEFVEPMLSFFQGMFTFYHQGHELAKDFNHYKMELQINI
QNTRNRFEGTRSEVEELMNKIRQHPKDHKRASQFTAEGYLYVQEKRPAPFGSSWVKHYCM
YRKAAKKFNMIPFEHRSGGKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPGVSLTL
QAFSEEERKQLEALGEKSLFHSFNRAIIPRPEGSAQLDKMGFTILRKCISAVETRGINDQ
GLYRVVGVSSKVQRLLSMLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLPEPLMTYE
LHGDFIVPAKSGSPESRVNAIHFLVHKLPEKNKEMLDILVKHLTNVSNHSKQNLMTVANL
GVVFGPTLMRPQEETVAAIMDLKFQNIVVEILIENHEKIFRTPPDATFPETTCLSASPPN
APPRQSKRQGQRTKRPVAVYNLCLELEDGDSSNPPKEDTPTSSADSLSSPSPTTAAVHGP
PGPDKNHLLADGGGSGDWASPIPSQTRSPMVQWLNPQSPTTPSSDSAVTPPSPRSSPFPL
CPPAPIVDKPPESVTSRKARAVYPCEAEHSSELSFEIGAIFEDVQTSREPGWLEGTLNGK
RGLIPQNYVKLL
Download sequence
Identical sequences ENSMICP00000000530 ENSMICP00000000530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]