SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000573 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000573
Domain Number 1 Region: 498-683
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 281-413
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-23
Family Pleckstrin-homology domain (PH domain) 0.0000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000573   Gene: ENSMICG00000000638   Transcript: ENSMICT00000000637
Sequence length 688
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3674:242600:269137:1 gene:ENSMICG00000000638 transcript:ENSMICT00000000637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDDIGYIGYRSYSPSFQRRTGLLHALSFRDSPFGGLPTFNLAQSPAPFPPDAAEPPRGV
RPEPSARALEPPADDRRDEVVLRQKPPTGRKIQLTPARQMNLGLGDESPEPEASGRGDRL
GRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSSPTF
TFALGRHYSQDCSSIKAGRRSSYLLAITTERSKSCDDGLNTFRDEGRPLRRLPDRVPSLR
VLRSFFTDGSLDSWGTSEDADAPSKRHSTSDLSDATFSDIRREGWLCYKQILTKKGKKTG
SGLHQWKRVYPPLRARSLSLSKERREPGPAAGAAAAGAGEDEAAPVCIGSCLVDISYSET
KRRHVFRLTTADFCEYLFQAEDRDDMLGWIRAIRENSRAEGEDPGCANQALISKKLNDYR
KVSHSSGPKADSSPKGSRGLGGLKSEFLKQSTARGLRAQDQPTGSKSSKALITKTPCISL
PQRNKENSGNAFILYQASHRVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLN
RGPGDINLQDERWQDLNVISSLLKSFFRKLPEPLFTDXXXXXXXXXXXXXXXXXXXXXXX
XXIRDLPGHYYETLKFLVGHLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTH
MPDRYKIVETLIQHSDWFFSDEEDKGER
Download sequence
Identical sequences ENSMICP00000000573 ENSMICP00000000573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]