SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000652 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000652
Domain Number 1 Region: 513-559
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000103
Family TSP-1 type 1 repeat 0.00071
Further Details:      
 
Domain Number 2 Region: 92-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000615
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000000652
Domain Number - Region: 467-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000907
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 29-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.034
Family TSP-1 type 1 repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000652   Gene: ENSMICG00000000727   Transcript: ENSMICT00000000725
Sequence length 565
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4263:206589:255127:-1 gene:ENSMICG00000000727 transcript:ENSMICT00000000725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEGLHSFESSVVNRSFAKSRQTRSVDVTPMPIDCELSSWSSWTACDPCQKKRXXXXXXXX
XXXXHGDPCNSFDKEVEDCVTTRPCRSQVRCEGFVCPQTGRCINRRLLCNGDNDCGDQSD
EANCRRIYKKCQHEMDQYWAIGNLASGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKQLPLEYSYG
EYRDLFRDFGTHYITEAVLGGIYEYTLIMNKEAMERADYSLSNVHACAKNDFKIGGAIKE
VYVRLGVSESKCRDILNEIKDRNKRSTMVEDLVVLIRGGASEHITALAFKELPTAELMQE
WGDAVQYNPAIVKVKVEPLYELVTATDFAFSSTVRQNMKQALEEFQKEVSSCHCAPCQGN
GVPVLKESRCDCICPVGFQGPACEITDRKNVPVDGKWRCWSNWSACSGGQKTRQRQCDSP
PPQNGGSPCSGPASETLNCGRGSFH
Download sequence
Identical sequences ENSMICP00000000652 ENSMICP00000000652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]