SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000686 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000686
Domain Number 1 Region: 125-253
Classification Level Classification E-value
Superfamily DNA clamp 1.26e-47
Family DNA polymerase processivity factor 0.000000334
Further Details:      
 
Domain Number 2 Region: 1-109
Classification Level Classification E-value
Superfamily DNA clamp 3.71e-37
Family DNA polymerase processivity factor 0.00000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000686   Gene: ENSMICG00000000764   Transcript: ENSMICT00000000763
Sequence length 259
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_606:88622:93145:-1 gene:ENSMICG00000000764 transcript:ENSMICT00000000763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEVSDYAMRMDLD
VEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKL
SQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIA
DMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences ENSMICP00000000686 ENSMICP00000000686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]