SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000822 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000822
Domain Number 1 Region: 38-95
Classification Level Classification E-value
Superfamily SRP19 8.63e-17
Family SRP19 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000822   Gene: ENSMICG00000000914   Transcript: ENSMICT00000000912
Sequence length 100
Comment pep:novel genescaffold:micMur1:GeneScaffold_4871:1167:4682:1 gene:ENSMICG00000000914 transcript:ENSMICT00000000912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDXXXXXXXXXXXXXXXXXXXXXXXXXXAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDAQYRGRVRIQLKQEDGSLCLVQFPS
Download sequence
Identical sequences ENSMICP00000000822 ENSMICP00000000822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]