SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000000952 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000000952
Domain Number 1 Region: 82-181
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-31
Family SH2 domain 0.0000764
Further Details:      
 
Domain Number 2 Region: 27-78
Classification Level Classification E-value
Superfamily SH3-domain 0.00000213
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000000952   Gene: ENSMICG00000001048   Transcript: ENSMICT00000001047
Sequence length 275
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_189:157756:178512:-1 gene:ENSMICG00000001048 transcript:ENSMICT00000001047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSMKSTPAPPERPLPSPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRIISDEGGWWK
AISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFY
SLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQST
AAPEVRDSSSPVTLRQKPVDWKRVSLQEDPEGAENPLGVDESLFSYGLRESIASYLSLTS
DDNASFDRKKKSVSLMYSGSKRKSSFFSSPPYFED
Download sequence
Identical sequences ENSMICP00000000952 ENSMICP00000000952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]