SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001178 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001178
Domain Number 1 Region: 444-488
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000497
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000001178
Domain Number - Region: 387-405
Classification Level Classification E-value
Superfamily SRCR-like 0.00484
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001178   Gene: ENSMICG00000001288   Transcript: ENSMICT00000001290
Sequence length 490
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3380:61593:154013:-1 gene:ENSMICG00000001288 transcript:ENSMICT00000001290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENKAMYLHTVSDRDTGSILEEPFDGRSLSKLNLCEDGPCHKRRAGGCCTQLGSLSALKH
AVLGLYLLVFLILVGIFILAVSRPRSSPDDLKALTRNVNRLNESFRDLQLRLLQAPLQAD
LSEQVWKVQDALQNQSDSLLALAGAVQRLEGALWGLHAQAAQTEQAVALLRDRTGQQSDA
AQLELYQLQVESNGSQLLLRHAGLLNGARVGVLGEELADVGGALPRLNHSLSYDGALHRT
LQDLQVLVSNASENTRRMLAHLGMELQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPPGPKGDQGNEGKEGQPGIPGSPGLRGLPGERGTPGLPGPKGDDGKLGATGPMGMRGFK
GDRGPKGEKGEKGDRAGDASVVEAPMLIRLVNGSGPHEGRVEVYXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSGRIWMDDVACKGTEDSIFRCSFSKWGVTNCGHA
EDAGVTCNRY
Download sequence
Identical sequences ENSMICP00000001178 ENSMICP00000001178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]