SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001221 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001221
Domain Number 1 Region: 240-310
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000188
Family BCR-homology GTPase activation domain (BH-domain) 0.0033
Further Details:      
 
Domain Number 2 Region: 149-187
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000549
Family BCR-homology GTPase activation domain (BH-domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001221   Gene: ENSMICG00000001343   Transcript: ENSMICT00000001343
Sequence length 414
Comment pep:novel genescaffold:micMur1:GeneScaffold_2484:145185:150353:1 gene:ENSMICG00000001343 transcript:ENSMICT00000001343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRNDRPNTLEKWFLILRRQQKVASLKTFGIRLEEVIANELTRRKHLELTAAMQIEEATSQ
ASGRRRRRRGNVVQRMCGRLRRFFSRRREEPTLPREFTRRGRRGAISVDSLAELEDGALL
LQTLQLSKVSFGVGRRLLGSKRKMSLSPIAKQIPQVVEVCCDFIEEHGLHTVGLFSLEHS
VQRVRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKP
QDQLSALQLLVYMLPSCHSDTLERLLRALHKITEHCEDSIGINGQLIPGNRMTSTNLALI
FGSALLKKGQCGQRETRKTSTGIDHYASVNVXXXXXXXXXXXXXVPPHIQKQVAKRVWTS
SPEAHDFIRRRNLRKIQSAHMKVEEDSLLSDPVDVETSDEVEADIFAQSESFDE
Download sequence
Identical sequences ENSMICP00000001221 ENSMICP00000001221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]