SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001401 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001401
Domain Number 1 Region: 260-471
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.83e-57
Family G proteins 0.000000988
Further Details:      
 
Domain Number 2 Region: 602-685
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.17e-21
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00053
Further Details:      
 
Domain Number 3 Region: 501-560
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000156
Family Elongation factors 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001401   Gene: ENSMICG00000001533   Transcript: ENSMICT00000001541
Sequence length 686
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1410:310736:419966:-1 gene:ENSMICG00000001533 transcript:ENSMICT00000001541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRRDKPSVVEPVEEYDYE
DLRESSNSLSNHQLSAIDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGSQSSRNESEIVPKVAKMTVSGKKQTMGFEVP
GVTSEANDHNFHTPQKGPPSEDASIATSDVLEMMSKSAIPPHTIQASEEQSSTPTPVKRS
GKLRQQIDVKAELEKRQGGKQLLNLVVIGHVDAGKSTLMGHMLYLLGNVNKRTMHKYEQE
SKKAGKASFAYAWVLDETXXXXXXGVTMDVGMTKFETTTKVITLMDAPGHKDFIPNMITG
AAQADVAVLVVDASRGEFEAGFETGGQTREHGLLVRSLGVTQLAVAVNKMDQVNWQQERF
QEITGKLGHFLKQAGFKEGDVAFIPTSGLSGDNLITRSQSSELTKWYKGVCLLEQIXXXX
XXXXXXXXXXXXXXXXXXXXQGSGFCVTGKIEAGYIQTGDRLLAMPPNETCTAKGITLHD
EPVDWAAAGDHVSLTLVGMDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XVLLHYQTVSEPAVIKRLISVLNKSTGEVTKKKPKLLTKGQNALVELQTQRPIALELYKD
FKELGRFMLRYSGSTIAAGVVTEIKE
Download sequence
Identical sequences ENSMICP00000001401 ENSMICP00000001401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]