SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001420 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001420
Domain Number 1 Region: 1187-1354
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-46
Family DBL homology domain (DH-domain) 0.00000032
Further Details:      
 
Domain Number 2 Region: 1410-1545
Classification Level Classification E-value
Superfamily PH domain-like 1.71e-29
Family Pleckstrin-homology domain (PH domain) 0.0000026
Further Details:      
 
Domain Number 3 Region: 1581-1680
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.36e-20
Family PLC-like (P variant) 0.0052
Further Details:      
 
Domain Number 4 Region: 970-1033
Classification Level Classification E-value
Superfamily SH3-domain 9.98e-20
Family SH3-domain 0.0000309
Further Details:      
 
Domain Number 5 Region: 8-107
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000692
Family Eps15 homology domain (EH domain) 0.0028
Further Details:      
 
Domain Number 6 Region: 1041-1088
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000919
Family SH3-domain 0.00018
Further Details:      
 
Domain Number 7 Region: 783-820
Classification Level Classification E-value
Superfamily SH3-domain 0.000000147
Family SH3-domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000001420
Domain Number - Region: 935-952
Classification Level Classification E-value
Superfamily SH3-domain 0.0507
Family SH3-domain 0.0028
Further Details:      
 
Domain Number - Region: 230-265
Classification Level Classification E-value
Superfamily EF-hand 0.0609
Family Eps15 homology domain (EH domain) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001420   Gene: ENSMICG00000001552   Transcript: ENSMICT00000001563
Sequence length 1690
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3671:218044:336114:-1 gene:ENSMICG00000001552 transcript:ENSMICT00000001563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAQFPTAMNGGPNMWAITSEERTKHDKQFDNLKPSGGYITXXXXXXXXXXXXXXXXXXX
XXXALSDLNKDGKMDQQEFSIAMKLIKLKLQGQQLPMVLPPIMKQPPMFSPLISARFXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTSSTASLSGNSPKTGTSEWAV
PQPSRLKYRQKFNSLDKSMSGYLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXNGKHQQISGRLQDVRLRKQTQKTELEVLDKQCDLEIMEIKQL
QQELQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXCGNLDDSILQCLLSLLSCLNNLFLLLKELRESYNTQQLA
LEQLHKIKRDKLKEIERKRLELIQKKKLEDEAARKAKQGKENLWRESLRKEEEEKQKRLQ
EEKTQEKIQEEERKVEEKQCKDKDKIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
VDEKTIGEPGWLYGSFQGSFGWFPCNYVEKMPSGEKAVSPKKALLPPTVSLPATSTSFXX
XXXXXXXXXXXXXXXXFSLSVNTSWQKKSAFTRTVSPGSISPIHGQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGWFPKSYVKIIPGSEVKREEPEALY
AAVNKKPTSAACPVGEEYIALYPYSSVEPGDLTFTEGEEILVTQKDGEWWTGSIGDRTGI
FPSNYVKPKDQESFGSASKSGASNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNTS
GWWQGELQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCADLQTLDTMQPIER
KRQGYIHELIQTEERYMDDLQLVVEVFQKRMAESGFLTEGEMALIFVNWKELIMSNTKLL
KALRVRKKTGGEKMPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEDTDFKEF
LKKLASDPRCKGMPLSSFLLKPMQRITRYPLLIRSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLIFNSLTNCLGPRKLLHSGKLYKTKSNK
ELHGFLFNDFLLLTYMVKQFAVYSGSEKLFSSKSNAQLKMYKMPIFLNEVLVKLPTDPSS
DEPVFHISHIDRVYTLRTENINERTAWVQKIKAASEQYIDTEKKKREKAYQARSQKTSGI
GAXXXXXXXXXXXXXXXXXXXKSNPYCEISMGSQSYTTRTIQDTLNPKWNFNCQFFIKDL
YQDVLCLTMFDRDQFSPDDFLGRTEVPVAKIRTEQESKGPVTRRLLLHEVPTGEVWVRFD
LQLFEQKTLL
Download sequence
Identical sequences ENSMICP00000001420 ENSMICP00000001420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]