SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001452 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001452
Domain Number 1 Region: 14-178
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.24e-44
Family G proteins 0.000099
Further Details:      
 
Domain Number 2 Region: 171-270
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.14e-18
Family Chaperone J-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001452   Gene: ENSMICG00000001603   Transcript: ENSMICT00000001598
Sequence length 273
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_3671:871614:903166:-1 gene:ENSMICG00000001603 transcript:ENSMICT00000001598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANMPKRKEPGKSLRIKVISMGNAEVGKSCIIKRYCEKRFVSKYLATIGIDYGVTKVQV
RDREIKVNIFDMAGHPFFYEVRNEFYKDTQGVILVYDVGQKDSFDALDAWLAEMKQELGP
HGNMENIIFVVCANKIDCTKHRCVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYV
SIVDLCENGGKRPTTNSSASFTKEQADTIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKL
AVLLHPDKCVAPGSEDAFKAVVNARTALLKTIK
Download sequence
Identical sequences ENSMICP00000001452 ENSMICP00000001452 XP_012643576.1.48125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]