SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001681 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001681
Domain Number 1 Region: 1570-1813
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.68e-52
Family Ankyrin repeat 0.00000112
Further Details:      
 
Domain Number 2 Region: 507-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000821
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 469-511
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000365
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 4 Region: 152-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 545-588
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 6 Region: 923-1046
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000267
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 437-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 723-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000186
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 583-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000261
Family EGF-type module 0.016
Further Details:      
 
Domain Number 10 Region: 1250-1281
Classification Level Classification E-value
Superfamily Notch domain 0.000000144
Family Notch domain 0.0024
Further Details:      
 
Domain Number 11 Region: 686-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000274
Family EGF-type module 0.019
Further Details:      
 
Domain Number 12 Region: 808-929
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000471
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 13 Region: 1213-1243
Classification Level Classification E-value
Superfamily Notch domain 0.00000301
Family Notch domain 0.0065
Further Details:      
 
Domain Number 14 Region: 60-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000317
Family EGF-type module 0.026
Further Details:      
 
Domain Number 15 Region: 114-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000021
Family EGF-type module 0.045
Further Details:      
 
Domain Number 16 Region: 1037-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000504
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000001681
Domain Number - Region: 29-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000839
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 1131-1169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00136
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1086-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00353
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1172-1201
Classification Level Classification E-value
Superfamily Notch domain 0.00615
Family Notch domain 0.0037
Further Details:      
 
Domain Number - Region: 621-651
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001681   Gene: ENSMICG00000001835   Transcript: ENSMICT00000001844
Sequence length 1989
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4629:87060:124154:-1 gene:ENSMICG00000001835 transcript:ENSMICT00000001844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLLLLLLCFSVASARGGILLADWTNGGACLSLPQGQGACQCAPGFLGETCQIPD
PCQDAQLCQNGGSCQALPPAPRGSPSPPSHLAPGFFCTCPPGFTGERCQDRLKDPCPPSF
CSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCANGGLCLATYPQIQCRCPPGF
EGHACEHDVNECFLDPAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXQQGPSPCEHGGSCLNTPGSFHCLCPPGYTGSRCEADHNECLSQPCRP
GSTCLDLLATFHCLCPPGLQGQLCEVETDECASAPCLNHADCRDLLDGFLCVCLPGFAGT
HCEQDINECESSPCANGGQCQDQPGAFHCECLPGFEGPRCQAEVHKCLSGPCPVGASCLD
LPGAFFCLCPSGFTGQLCKVPLCAPNLCQPKQTCQDQKDKTHCLCPDGNPGCAPAEDNCT
CQHGHCQRSSCVCDVGWTGPECEAELGGCISTPCAHGGTCSPQPSGYSCTCPTSHTGPTC
SEEVTACHSGPCLNGGSCSPSPGGYSCTCPPSHTGPRCQASTEHCGTHXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPCRNGATCQESPQGPRCLCPPGYTGGSCQTPL
DLCAQKPCPHAARCLQTGPSFQCQCLQGWTGPLCDLPLSSCQKAALSQGVEVSALCQNGG
LCVDSGPSYFCHCPPGFQGSSCQDTVNPCESRPCHHGATCVAQPHGYLCQCVPGYSGQNC
SMEPDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGTAACHS
LANAFYCQCLPGHTGQWCEVEIDPCQSQPCFHGGSCEAIAGPPPGFICHCPKVIGFEGPT
CSQRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPQGCGPPSPCLYN
GSCSETPGLTGPGFRCSCPPNSPGPRCQRPGAKGCEGRGGDGACDNGCSGPGGNWDGGDC
SLGVPDPWKGCPSRSRCWRLFRDGQCHPQCDSEECLFDGYDCETPPACIPAYNQYCRDHF
HNGHCEKGCNTAECGWDGGDCRPEDGDSEWGPSLALLVVLSPQALDQQLLALARVLSLTL
RVGLWVRKDSEGRDMVYPYPGARAEEELGGTRDPSHQEGAASETQPLDSLNAGFVVVMGV
DLSHCGPDHPASHCPWDPGLLLRLLAAMAAVGTLEPLLPGPLLAAHPHTGSVPPANRLPW
PVLGSPVAGVILLALGALLVLQLVRRRREHGALWLPPGFTRRPRTQPAPRRRRPPLGEDS
IGLKALKPEAEVDEDGVVMCSGPEEGEAVGQAEETASCSKCQLWPLSSGCGELAQTAMLT
PPQESETETPDLDTRGPDGVTPLMSAVCCGGVEPRTFQGAWLASPEPWEPLLDEGACPQA
HTVGTGETPLHLAARFSRPTAARRLLEAGANPNQADRAGRTPLHAAVAADAREVCQLLLR
SRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKWGKTALHWAAAVNNAR
AARSLLQAGSDKDAQDGREQTPLFLAAREGAVEVAQLLLALGAARELRDQAGLAPGDVAR
LRNHWDLLTLLEGAGPPEASHKASPGREAGAERRARTASASAPPHGGGAAPRCRTLSAGA
GPRAGGARLGARTGSVGWATRGGAAYSHCRSLSGGAAGGGPPLRGRTFSAGLRGPRRYPA
MRDRVAGRGGRSADDWPCDWVALGACGPTNIPIPPPCLTPSPERGSPQVAWGPPAHQETP
LNLEGESQK
Download sequence
Identical sequences ENSMICP00000001681 ENSMICP00000001681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]