SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001824 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001824
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 3.66e-50
Family Rhodopsin-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001824   Gene: ENSMICG00000002000   Transcript: ENSMICT00000001996
Sequence length 206
Comment pep:novel scaffold:micMur1:scaffold_27335:4260:4877:1 gene:ENSMICG00000002000 transcript:ENSMICT00000001996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEIFLSEKKTISYPACLVQCYLFIALVHVEMYILAVMAFDRYMAICNPLLYGSKMSKSV
CTSLITVPYVYGALTGLMETMWTYNLAFCGPNKINHFYCADPPLIKLACSDTYNKETSMF
VVAGFNFTYSLLIILISYIYIFPAILRIRSTEGRRKAFSTCGSHLTAVTIFFVALFFMYL
RPPSEESVEQGKMVAVFYTTVIPMFN
Download sequence
Identical sequences ENSMICP00000001824 ENSMICP00000001824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]