SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001868 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001868
Domain Number 1 Region: 12-245,392-516
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-44
Family FAD-linked reductases, N-terminal domain 0.000000000486
Further Details:      
 
Domain Number 2 Region: 368-408
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000072
Family L-aminoacid/polyamine oxidase 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001868   Gene: ENSMICG00000002042   Transcript: ENSMICT00000002042
Sequence length 525
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4326:50904:127488:1 gene:ENSMICG00000002042 transcript:ENSMICT00000002042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASREKTSVADHMFDVVVIGGGISGLSAAKLLSEHDVNVLVLEARDRVGGRTYTVRNKHV
NYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKSYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWQAPHAEEWDRMTMKELINKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFIGGSGQVSERMMDLLGVRVKL
KCPTYVDQSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXKKKICELYAKVLGSQEALQPVHYEEKNWCEEQYSGGCYTAYFPPGIMTLYRV
IRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKVAKKDIWVQEPESKDIP
SIEISRTFWERNLPSVSGLLKILGFSTTVTVLWIVMHKFKPLARS
Download sequence
Identical sequences ENSMICP00000001868 ENSMICP00000001868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]