SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001876 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001876
Domain Number 1 Region: 581-649
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.7e-19
Family Complement control module/SCR domain 0.0072
Further Details:      
 
Domain Number 2 Region: 453-519
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.19e-17
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000278
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 336-400
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000708
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000567
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 154-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000183
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 7 Region: 91-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000337
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 8 Region: 25-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000101
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001876   Gene: ENSMICG00000002052   Transcript: ENSMICT00000002050
Sequence length 653
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2310:5799:22912:-1 gene:ENSMICG00000002052 transcript:ENSMICT00000002050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKNLTFIIILIIPGELYAEEKPCGFPHVENGRIAQYYYPFKSFYFPMRVDEKLSFFCL
AGYTTETGKQEERTTCTAAGWAPAPKCFKKCTKPDLKNGYFPDVKVVYKIQENMRYSCAS
GYKTAGGKDEEVVQCLSDGWSSPPACRKEQETCLAPELYNGNYSTTQKTFKVKDRVQYAC
AAGYHTAGGKTAEEAECHSHGWSVTPQCSKLKCSSLRLIENGYFHPVKQTYEEGDVVQFF
CHENYHLSGSDLIQCYNFGWYPESPVCEGRRNRCPPPPLPLNSKTQTYSTTYRHGEIVRI
ECELDFEIQGSEDLRCENGKWTEPPRCIEGKEKTACEGPPAVRNGAAHLRSGIFRNGDKV
TYRCEPGYYLRGPEAITCRRGKWTLPPECVENNEDCKPPPDVINGAVVGGSLANYTTGXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCTVNVDHMNRNNIEMKWEYEGKVLHGD
LIDFACKQGFVLSPSAPPSALSVQCSRGEVKYPLCIRKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCTLSSVEMEKNNLLLKWEF
DNRPHIFHGEYIEFLCKRDTYRAMPHIIESELRVQCERGQLKYPSCVPRDFHQ
Download sequence
Identical sequences ENSMICP00000001876 ENSMICP00000001876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]