SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000001997 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000001997
Domain Number 1 Region: 188-290
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-22
Family SH3-domain 0.0000774
Further Details:      
 
Domain Number 2 Region: 111-168
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-22
Family SH3-domain 0.00065
Further Details:      
 
Domain Number 3 Region: 5-61
Classification Level Classification E-value
Superfamily SH3-domain 3.15e-17
Family SH3-domain 0.00081
Further Details:      
 
Domain Number 4 Region: 258-364
Classification Level Classification E-value
Superfamily SH2 domain 1.02e-16
Family SH2 domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000001997   Gene: ENSMICG00000002188   Transcript: ENSMICT00000002182
Sequence length 377
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2857:38917:60410:1 gene:ENSMICG00000002188 transcript:ENSMICT00000002182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTIMQNNPLTSSMEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDSXXXXXXXXPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
Download sequence
Identical sequences ENSMICP00000001997 ENSMICP00000001997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]