SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002063 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002063
Domain Number 1 Region: 39-215
Classification Level Classification E-value
Superfamily PR-1-like 2.75e-54
Family PR-1-like 0.0001
Further Details:      
 
Domain Number 2 Region: 284-382
Classification Level Classification E-value
Superfamily LCCL domain 2.88e-29
Family LCCL domain 0.00097
Further Details:      
 
Domain Number 3 Region: 386-491
Classification Level Classification E-value
Superfamily LCCL domain 2.22e-28
Family LCCL domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002063   Gene: ENSMICG00000002251   Transcript: ENSMICT00000002255
Sequence length 497
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_855:4609:51521:1 gene:ENSMICG00000002251 transcript:ENSMICT00000002255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRVLGCAVPLGLVLLVCGAQGYFLPNVTRLGELLGRYQRAEPHSRARRAIPREDREEIL
MLHNKLRGQVHPPAANMEYMTWDEELERSAAAWAQECVWEHGPARLLVSIGQNLAVHWGR
YRSPGFHVQSWYDEVKDYTYPYPHECNPWCPERCSGAMCTHYTQIVWATTNKVGCAVNTC
PRMNVWGEVWENAVYLVCNYSPKGNWIGEAPYKNGRPCSQCPPSYGGGCRNNLCYREETY
HQKPETDEMNEVEVSPVPEEKHVWVQPRVSRPAKPKKAPAVSYMTQVVRCDTKMKDKCKG
STCNRYQCPAGCLRNKAKIFGTLFYESSSSICRAAIHHGVLDDQGGLVDVTRNGKVPFFV
KSERNGLESLSKYKPSGSFTVSKVKVQDLDCYTTVAQLCPFEKPAVHCPRVRCPAHCKDE
PSYWAPVFGTNIYADTSSICKSALHAGVIGDGSGGYVDVMPVDKKKSYAGSLRNGVQSES
LDSPRDGKAFRIFAVRQ
Download sequence
Identical sequences ENSMICP00000002063 ENSMICP00000002063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]