SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002246 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002246
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Lysozyme-like 7.88e-42
Family C-type lysozyme 0.00000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002246   Gene: ENSMICG00000002462   Transcript: ENSMICT00000002461
Sequence length 102
Comment pep:known_by_projection scaffold:micMur1:scaffold_5043:11336:15291:1 gene:ENSMICG00000002462 transcript:ENSMICT00000002461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLARWESSYNTRATNYNPGDRSTDYGIFQINSRYWCNDGKTPRAVNACGISCNALLQDD
ITQAINCAKRVVRDPQGIRAWVAWRNRCQNRDLTEYIRGCGV
Download sequence
Identical sequences ENSMICP00000002246 ENSMICP00000002246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]