SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002463 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002463
Domain Number 1 Region: 547-578,717-791
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000012
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002463   Gene: ENSMICG00000002704   Transcript: ENSMICT00000002705
Sequence length 977
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_2828:223540:303212:-1 gene:ENSMICG00000002704 transcript:ENSMICT00000002705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQGERSVISAASSKHRQNSYVYDVKRDVYNEETFQQKHKRRLSSSGNVDINITTVKHHV
QCRCSWHRFLRCMLTIFPFLEWMCMYRFKYWLLGDLLAGLSVGLVQVPQGLMYSLLARQL
IPPLNVAYAAFCSSVIYVIFGSCHQMSIGCFSLVSALMVNVLKVSPFNSGHLVMGTFVKD
DFSVPTFFANYNRSLSVVAATTFLTGIIQLSMGAIGLGLISTYLPEATISAYLAGTALHI
MLSQLTCVFGVMISFHSGAISLFYNIINYCLGLPKANSTSILLFLTAIVALRINKCIKIS
FYQYPIEFPMELFLILGFTAFANRISMATESSKTLIDMIPYSFLFPVTPDYSIFPKIIAQ
AFSLSLVSSFLLIFLGKKISSPHNYRVNSNQDLIAIGLCNVVSSFFRSCVFTGAVARTII
QDKSGGRQQXXXXXXXXXXXXXXXXXXXXXXXXXXAVLAGIIMSNVLPYLETIYNLPSLW
RKDQYDCAIWMVTFLSTIFLGLDIGLVISLFFAFFIVTVRSHRTQILLLGQIPNTNIYRS
INDYGEIVSIPGVKVFQCCNAVTFVNVYQLKHKLLKEVDMERVPLKEEEIFTLFNQSDTM
LQEKRICRCFCDCEEQEPPPRIGYTDRFVNKEDRDSSSINLIRCSRFNSGDTSQSTSDEQ
VPYTSSSSSQRYQGQNYEDVEDVWLQKEPSRYSSIPGTESVESRGRSRSIIPYSEDMLPP
THTIILDFSMVHHVDPWALVILRQICNAFQNANILVLIAGCHSSVVRAFETNDFFDAGIT
KAQLFLSIHDAVLFAVSRKFLEPSDLSVDESETVIQETYSETDKIDHARHKMSRSLPEGS
KYANPGFANTREPAEEESELDLQLPQQQSELDLDLDLGPELEPESEQEPETEPEQEPETE
PEQEPLTETETDLELELGPKSRPRVYPLSWQQYRPVYRPVASSPPPQPQQPQTRSGERRR
YHMDPYSAEGNCNEDIW
Download sequence
Identical sequences ENSMICP00000002463 ENSMICP00000002463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]