SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002481 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002481
Domain Number 1 Region: 571-601,640-718
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002481   Gene: ENSMICG00000002729   Transcript: ENSMICT00000002725
Sequence length 738
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1239:454037:458168:1 gene:ENSMICG00000002729 transcript:ENSMICT00000002725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSESEEQHDVSPRDSAEGSDSPLSGIHLAPQKESSTDLKQFETNDQCRPYSRIHIEPQE
KENTNFKEFVITKLQKKCQCSPTKAKNIIFGFFPVLQWLPKYNLKKNILGDLMSGLIVGI
LLVPQSIAYSLLAGQEPIYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGEVVDREV
HKAGYDTALIAPPLGVFSNGSTLLNQTSDTLCDKSCYAIRVGSTVTFMAGVYQVAMGFFQ
VGFVSVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPIPTELIVVVAATLASHFGKLNENYNSSV
SGHIPTGFMPPKAPDWKLIPNVAVDAIAISVIGFAITVSLSEMFAKKHGYTVRANQEMYA
IGFCNIIPSFFHCFTTSAALAKTLVKESTGCQTQLSGVVTALVLLVLLVIAPLFYSLQKS
VLGVITIVNLRGALRKFRDLPKMWRVSRMDTVIWFVTMLSSALLSTELGLLVGVCFSMFC
VILRTQKPKNSLLGLVEESEIFESTSAYKNLETKQGIKIFRFVAPLYYINKECFKSALYK
KTVDPVLVKAAQRKAAKRKLKEKTVTLSGLQDEVSVQLSHEPLDLHTVVIDCSAIQFLDT
AGIHTLKEVRRDYKAIGIQVLLAQCNPSVRDSLTRGEYCKKEEENLLFYSVYEAMAFAEV
SQNQKGICVPNGLSLSSD
Download sequence
Identical sequences ENSMICP00000002481 ENSMICP00000002481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]