SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002551 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002551
Domain Number 1 Region: 12-147
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.35e-21
Family DEP domain 0.04
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000002551
Domain Number - Region: 587-627
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000334
Family BCR-homology GTPase activation domain (BH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002551   Gene: ENSMICG00000002794   Transcript: ENSMICT00000002801
Sequence length 773
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_1342:115770:136753:-1 gene:ENSMICG00000002794 transcript:ENSMICT00000002801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRGVPPGPYRATKLWNEVTTSFRTGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNN
SNFGPEVTRQQTIQLLRKFLKNHVIEDIKGRWXLENFPTTSPLKTLPRRHPELRKNSIEN
FSKDKDSIFKLRNFSRRTPKKHGLHFSQENTEKINHEIINEDQENLVDNREISQEDVEEV
WRCIILIYLETILGVPSLEEVINPRQVILQYXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVCGYI
TVSDRPSGIHRIQDHPQSSKTHHLNNLNSFKSTECLLLSLLHKDKNKEESDSTQRLQISD
QGFQERCAKKMQLVNVKNRRASTNDVMGGSCHNLIGLRSMHVLSSNIKPRCYSLEGIVDM
PGNSSKETSSVFHQSVLNIEGQNNEQFLESEPKQEFLLNLHSQESNQKPFSVGFKRTSTL
TVQDQEELYNGKCKSKQLCRSQSLLLRSSTRRNSYINTPVAEIIMKPNLGQGNTSVQTAM
GSELGESSTTINKRLCKSTIELTENSLPPASSMLTGTQSLLQPHLERVAIDALQLCCLLL
PPPNRRKLQLLMRMISRMSQNVDMPKLHDAMGTRSLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKGHVSIVSLQVLCISQLQVANLAQTSLI
KKGDFISSYKQTLKVRNIDRIWNLSSYRTLSIPPSLIFALVLYLAVAPSHDEE
Download sequence
Identical sequences ENSMICP00000002551 ENSMICP00000002551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]