SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002613 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002613
Domain Number 1 Region: 1192-1527
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.02e-82
Family p120GAP domain-like 0.0000000000351
Further Details:      
 
Domain Number 2 Region: 1832-1859,1895-2285,2359-2404,2637-2714
Classification Level Classification E-value
Superfamily ARM repeat 0.00000003
Family Armadillo repeat 0.032
Further Details:      
 
Domain Number 3 Region: 256-369,552-590,662-700,731-773,908-972,1128-1354
Classification Level Classification E-value
Superfamily ARM repeat 0.0000115
Family MIF4G domain-like 0.042
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000002613
Domain Number - Region: 1562-1664
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00314
Family CRAL/TRIO domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002613   Gene: ENSMICG00000002852   Transcript: ENSMICT00000002870
Sequence length 2816
Comment pep:known_by_projection genescaffold:micMur1:GeneScaffold_4390:26255:302117:1 gene:ENSMICG00000002852 transcript:ENSMICT00000002870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNVNNMRIFGEAAEKNLY
LSQLIILDTLEKCLAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXAFWNWVENYPDEFTKLYQIPQTDMAECAEKLFDLVDGFAEST
KRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFLDSLRKALAGHGGSRQLTESA
AIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNPSKPFSRGSQPADVDLMIDCL
VSCFRISPHNNQHFKICLAQNSPSTFHYVLVXXXXXXXXXSALDWWPKIDAVYCHSVELR
NMFGETLHKAVQGCGAHPAIRMAPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALLVLHQLDSIDL
WNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWLREILICRNKFLLKNKQADRS
SCHFLFPYGVGCDVPSGGNTSQMSMDHEELLRTCTPGASIRKGKGNSSMDSAAGCSGTPP
ICRQAQTKLEVALYMFLWSPDTEAVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTF
MEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDTHAKWEQATKLILNYPKAK
MEDGQAAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSNS
GLATYSPPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLSLMVCNHEKVGLQIRTNVK
DLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQFVEQTIAIMKNLLDNHTEG
SSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVEVMMARRXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVD
SGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQ
GELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGN
SLASKIMTFCFKVYGATYLQKLLDPLLRIVITSSDWQHVSFEVDPTPSESLRNQRNLLQM
TEKFFHAIISSSLEFPPQLRSVCHCLYQATCHSLLNKATVKEKKENKKSVVSQRFPQNSI
GAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKILQSIANHVLFTKEEHMR
PFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYL
SSNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKE
EFKALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIV
VDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGSTAV
QVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIVQ
SIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTC
TFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELK
HLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINKQMYPSIQAKIWGSLGQI
TDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCL
SPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTH
GLVINIIHSLCTCSQLHFSXXXXXXLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYR
DRSFSPGSYERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPS
LQPRALVVFGCISKRVSHGQIKQIIRILSKALESCLKGPDTYNSQVLIEATVIALTKLQP
LLNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPEEVFMAI
RNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRHPSPAIVARTVRILHTLLTLVNKH
RNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDP
TYRTLKENQPWSSPKGSEGYLAATYPTVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKS
FDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRISSSQQHPHLRKVSVSESNV
LLDEEVLTDPKIQALLLTVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNLLDS
KINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSYLQSFGFNGLWRFAGPFSKQTQ
IPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMT
SLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV
Download sequence
Identical sequences ENSMICP00000002613 ENSMICP00000002613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]