SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000002810 from Microcebus murinus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000002810
Domain Number 1 Region: 154-300
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.18e-42
Family Brix domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000002810   Gene: ENSMICG00000003093   Transcript: ENSMICT00000003091
Sequence length 302
Comment pep:novel genescaffold:micMur1:GeneScaffold_2294:356522:383897:1 gene:ENSMICG00000003093 transcript:ENSMICT00000003091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKSGEKIGGSGKKSLKRKAASGELQEAAVAEHETTESGVQPPKMAAFPPGFSISEIKNK
QRRHLMFTRWKQQQRKEKLAAKKRLKKEREALGDKAPPKPIPKTIDNQRVYDETIVDPND
EEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTVRLCEQLSTVIPNSHVYYRRGLAL
KKIIPQCISRDFTDLIVINEDRKTPNGLILSHLPNGPTAHFKMSSVRLRKEIKRRGKDPT
EHIPEVILNNFTTRLGHSIGRMVASLFPHNPQFIGRQVATFHNQRDYIFFRFHRYIFKSE
KE
Download sequence
Identical sequences ENSMICP00000002810 ENSMICP00000002810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]